Lineage for d1flcc1 (1flc C:218-321)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12156Fold b.19: Segmented RNA-genome viruses' proteins [49817] (1 superfamily)
  4. 12157Superfamily b.19.1: Segmented RNA-genome viruses' proteins [49818] (3 families) (S)
  5. 12227Family b.19.1.3: Hemagglutinin domain of haemagglutinin-esterase-fusion glycoprotein HEF1 [49826] (1 protein)
  6. 12228Protein Hemagglutinin domain of haemagglutinin-esterase-fusion glycoprotein HEF1 [49827] (1 species)
  7. 12229Species Influenza C virus [TaxId:11552] [49828] (1 PDB entry)
  8. 12231Domain d1flcc1: 1flc C:218-321 [23838]
    Other proteins in same PDB: d1flca2, d1flcb_, d1flcc2, d1flcd_, d1flce2, d1flcf_

Details for d1flcc1

PDB Entry: 1flc (more details), 3.2 Å

PDB Description: x-ray structure of the haemagglutinin-esterase-fusion glycoprotein of influenza c virus

SCOP Domain Sequences for d1flcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flcc1 b.19.1.3 (C:218-321) Hemagglutinin domain of haemagglutinin-esterase-fusion glycoprotein HEF1 {Influenza C virus}
hlvascyfiydskevynkrgcdnyfqviydsfgkvvggldnrvspytgnsgdtptmqcdm
lqlkpgrysvrssprfllmpersycfdmkekgpvtavqsiwgkg

SCOP Domain Coordinates for d1flcc1:

Click to download the PDB-style file with coordinates for d1flcc1.
(The format of our PDB-style files is described here.)

Timeline for d1flcc1: