Lineage for d4k0sa_ (4k0s A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2067966Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2067967Protein Carbonic anhydrase [51071] (10 species)
  7. 2068005Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (675 PDB entries)
    Uniprot P00918
  8. 2068439Domain d4k0sa_: 4k0s A: [238379]
    automated match to d4m2wa_
    complexed with azm, zn; mutant

Details for d4k0sa_

PDB Entry: 4k0s (more details), 1.8 Å

PDB Description: Structure of HCAIX mimic (HCAII with 5 mutations in active site) in complex with acetazolamide
PDB Compounds: (A:) Carbonic anhydrase 2

SCOPe Domain Sequences for d4k0sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k0sa_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hsfqvtfddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdlgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprgl
lpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk

SCOPe Domain Coordinates for d4k0sa_:

Click to download the PDB-style file with coordinates for d4k0sa_.
(The format of our PDB-style files is described here.)

Timeline for d4k0sa_: