![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein CD4 C2-set domains [49149] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49150] (32 PDB entries) |
![]() | Domain d4h8wc2: 4h8w C:98-176 [238360] Other proteins in same PDB: d4h8wc1, d4h8wh_, d4h8wl1, d4h8wl2 automated match to d1g9mc2 complexed with gol, mrd, nag |
PDB Entry: 4h8w (more details), 1.85 Å
SCOPe Domain Sequences for d4h8wc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h8wc2 b.1.1.3 (C:98-176) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} fgltansdthllqgqsltltlesppgsspsvqcrsprgkniqggktlsvsqlelqdsgtw tctvlqnqkkvefkidivv
Timeline for d4h8wc2: