Lineage for d4h8wc1 (4h8w C:1-97)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021468Protein CD4 V-set domains [48737] (2 species)
  7. 2021469Species Human (Homo sapiens) [TaxId:9606] [48738] (32 PDB entries)
  8. 2021474Domain d4h8wc1: 4h8w C:1-97 [238359]
    Other proteins in same PDB: d4h8wc2, d4h8wl1, d4h8wl2
    automated match to d1g9mc1
    complexed with gol, mrd, nag

Details for d4h8wc1

PDB Entry: 4h8w (more details), 1.85 Å

PDB Description: crystal structure of non-neutralizing and adcc-potent antibody n5-i5 in complex with hiv-1 clade a/e gp120 and scd4.
PDB Compounds: (C:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d4h8wc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h8wc1 b.1.1.1 (C:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

SCOPe Domain Coordinates for d4h8wc1:

Click to download the PDB-style file with coordinates for d4h8wc1.
(The format of our PDB-style files is described here.)

Timeline for d4h8wc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h8wc2