Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein CD4 V-set domains [48737] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48738] (32 PDB entries) |
Domain d4h8wc1: 4h8w C:1-97 [238359] Other proteins in same PDB: d4h8wc2, d4h8wl1, d4h8wl2 automated match to d1g9mc1 complexed with gol, mrd, nag |
PDB Entry: 4h8w (more details), 1.85 Å
SCOPe Domain Sequences for d4h8wc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h8wc1 b.1.1.1 (C:1-97) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs lwdqgnfpliiknlkiedsdtyicevedqkeevqllv
Timeline for d4h8wc1: