Lineage for d4cjmc_ (4cjm C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1316302Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1316303Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1316638Family b.42.1.0: automated matches [191477] (1 protein)
    not a true family
  6. 1316639Protein automated matches [190764] (1 species)
    not a true protein
  7. 1316640Species Human (Homo sapiens) [TaxId:9606] [187978] (2 PDB entries)
  8. 1316644Domain d4cjmc_: 4cjm C: [238348]
    automated match to d1ijta_
    complexed with so4

Details for d4cjmc_

PDB Entry: 4cjm (more details), 2.7 Å

PDB Description: crystal structure of human fgf18
PDB Compounds: (C:) fibroblast growth factor 18

SCOPe Domain Sequences for d4cjmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cjmc_ b.42.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlrlyqlysrtsgkhiqvlgrrisargedgdkyaqllvetdtfgsqvrikgketefylcm
nrkgklvgkpdgtskecvfiekvlennytalmsakysgwyvgftkkgrprkgpktrenqq
dvhfmkry

SCOPe Domain Coordinates for d4cjmc_:

Click to download the PDB-style file with coordinates for d4cjmc_.
(The format of our PDB-style files is described here.)

Timeline for d4cjmc_: