SCOPe 2.05: Domain d4cjmb_: 4cjm B:

Lineage for d4cjmb_ (4cjm B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.0: automated matches [191477] (1 protein)
   not a true family

6. Protein automated matches [190764] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187978] (4 PDB entries)

8. Domain d4cjmb_: 4cjm B: [238347]
   automated match to d1ijta_
   complexed with so4

Details for d4cjmb_

PDB Entry: 4cjm, 2.7 Å

PDB Description: crystal structure of human fgf18

PDB Compounds: (B:) fibroblast growth factor 18

SCOPe Domain Sequences for d4cjmb_:

Sequence; same for both SEQRES and ATOM records:

>d4cjmb_ b.42.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlrlyqlysrtsgkhiqvlgrrisargedgdkyaqllvetdtfgsqvrikgketefylcm
nrkgklvgkpdgtskecvfiekvlennytalmsakysgwyvgftkkgrprkgpktrenqq
dvhfmkry

Timeline for d4cjmb_:

• d4cjmb_ first appeared in SCOPe 2.03
  
• d4cjmb_ appears in SCOPe 2.04
  
• d4cjmb_ appears in SCOPe 2.06
  
• d4cjmb_ appears in the current release, SCOPe 2.08