Lineage for d4cg0a_ (4cg0 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1850575Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 1850576Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 1850577Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 1850648Protein Subtilisin [52745] (7 species)
  7. 1850716Species Bacillus lentus, savinase (TM) [TaxId:1467] [52749] (6 PDB entries)
    Uniprot P29600
  8. 1850719Domain d4cg0a_: 4cg0 A: [238343]
    automated match to d1svna_
    complexed with ca, na

Details for d4cg0a_

PDB Entry: 4cg0 (more details), 1.36 Å

PDB Description: Savinase crystal structures for combined single crystal diffraction and powder diffraction analysis
PDB Compounds: (A:) Subtilisin Savinase

SCOPe Domain Sequences for d4cg0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cg0a_ c.41.1.1 (A:) Subtilisin {Bacillus lentus, savinase (TM) [TaxId: 1467]}
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaatr

SCOPe Domain Coordinates for d4cg0a_:

Click to download the PDB-style file with coordinates for d4cg0a_.
(The format of our PDB-style files is described here.)

Timeline for d4cg0a_: