![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.41: Subtilisin-like [52742] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3 |
![]() | Superfamily c.41.1: Subtilisin-like [52743] (3 families) ![]() |
![]() | Family c.41.1.1: Subtilases [52744] (14 proteins) |
![]() | Protein Subtilisin [52745] (7 species) |
![]() | Species Bacillus lentus, savinase (TM) [TaxId:1467] [52749] (6 PDB entries) Uniprot P29600 |
![]() | Domain d4cg0a_: 4cg0 A: [238343] automated match to d1svna_ complexed with ca, na |
PDB Entry: 4cg0 (more details), 1.36 Å
SCOPe Domain Sequences for d4cg0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cg0a_ c.41.1.1 (A:) Subtilisin {Bacillus lentus, savinase (TM) [TaxId: 1467]} aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi rnhlkntatslgstnlygsglvnaeaatr
Timeline for d4cg0a_: