SCOPe 2.05: Domain d4cdfa_: 4cdf A:

Lineage for d4cdfa_ (4cdf A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.5: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75001] (2 families)
   automatically mapped to Pfam PF08773

5. Family b.61.5.1: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75002] (1 protein)

6. Protein Dipeptidyl peptidase I (cathepsin C), exclusion domain [75003] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75004] (7 PDB entries)

8. Domain d4cdfa_: 4cdf A: [238341]
   automated match to d4cddd_
   complexed with cl, nag, w2c

Details for d4cdfa_

PDB Entry: 4cdf, 2.2 Å

PDB Description: human dpp1 in complex with (2s,4s)-n-((1s)-1-cyano-2-(4-(4- cyanophenyl)phenyl)ethyl)-4-hydroxy-piperidine-2-carboxamide

PDB Compounds: (A:) dipeptidyl peptidase 1 exclusion domain chain

SCOPe Domain Sequences for d4cdfa_:

Sequence; same for both SEQRES and ATOM records:

>d4cdfa_ b.61.5.1 (A:) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Human (Homo sapiens) [TaxId: 9606]}
dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkvgt

Timeline for d4cdfa_:

• d4cdfa_ first appeared in SCOPe 2.03
  
• d4cdfa_ appears in SCOPe 2.04
  
• d4cdfa_ appears in SCOPe 2.06
  
• d4cdfa_ appears in the current release, SCOPe 2.08