Lineage for d4bgla_ (4bgl A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1769954Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) (S)
  5. 1770022Family b.1.13.0: automated matches [191383] (1 protein)
    not a true family
  6. 1770023Protein automated matches [190481] (2 species)
    not a true protein
  7. 1770024Species Archaeoglobus fulgidus [TaxId:2234] [237922] (2 PDB entries)
  8. 1770025Domain d4bgla_: 4bgl A: [238340]
    automated match to d4bffc_
    complexed with fe, gol

Details for d4bgla_

PDB Entry: 4bgl (more details), 1.9 Å

PDB Description: superoxide reductase (neelaredoxin) from archaeoglobus fulgidus
PDB Compounds: (A:) superoxide reductase

SCOPe Domain Sequences for d4bgla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bgla_ b.1.13.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
elfqtadwkkekhvpvievlraeggvvevkvsvgkeiphpnttehhiawielvfqpegsk
fpyvvgraefaahgasvdgpntsgvytdpvavfafkaeksgkltafsycnihglwmgeat
lsle

SCOPe Domain Coordinates for d4bgla_:

Click to download the PDB-style file with coordinates for d4bgla_.
(The format of our PDB-style files is described here.)

Timeline for d4bgla_: