Lineage for d5hmga_ (5hmg A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459240Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 459241Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 459286Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (1 protein)
  6. 459287Protein Hemagglutinin [49824] (1 species)
    includes rudiment esterase domain
  7. 459288Species Influenza A virus, different strains [TaxId:11320] [49825] (36 PDB entries)
  8. 459371Domain d5hmga_: 5hmg A: [23834]
    Other proteins in same PDB: d5hmgb_, d5hmgd_, d5hmgf_

Details for d5hmga_

PDB Entry: 5hmg (more details), 3.2 Å

PDB Description: refinement of the influenza virus hemagglutinin by simulated annealing

SCOP Domain Sequences for d5hmga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hmga_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains}
qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
tygacpkyvkqntlklatgmrnvpekqt

SCOP Domain Coordinates for d5hmga_:

Click to download the PDB-style file with coordinates for d5hmga_.
(The format of our PDB-style files is described here.)

Timeline for d5hmga_: