Lineage for d4bglc_ (4bgl C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764803Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) (S)
  5. 2764871Family b.1.13.0: automated matches [191383] (1 protein)
    not a true family
  6. 2764872Protein automated matches [190481] (2 species)
    not a true protein
  7. 2764873Species Archaeoglobus fulgidus [TaxId:2234] [237922] (2 PDB entries)
  8. 2764892Domain d4bglc_: 4bgl C: [238337]
    automated match to d4bffc_
    complexed with fe, gol

Details for d4bglc_

PDB Entry: 4bgl (more details), 1.9 Å

PDB Description: superoxide reductase (neelaredoxin) from archaeoglobus fulgidus
PDB Compounds: (C:) superoxide reductase

SCOPe Domain Sequences for d4bglc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bglc_ b.1.13.0 (C:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
elfqtadwkkekhvpvievlraeggvvevkvsvgkeiphpnttehhiawielvfqpegsk
fpyvvgraefaahgasvdgpntsgvytdpvavfafkaeksgkltafsycnihglwmgeat
lsle

SCOPe Domain Coordinates for d4bglc_:

Click to download the PDB-style file with coordinates for d4bglc_.
(The format of our PDB-style files is described here.)

Timeline for d4bglc_: