SCOPe 2.06: Domain d3wjda_: 3wjd A:

Lineage for d3wjda_ (3wjd A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.8: Rv2717c-like [141475] (3 proteins)
   bacterial and plant proteins with a fatty acid binding protein-like fold
   automatically mapped to Pfam PF08768

6. Protein automated matches [238328] (1 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [238329] (6 PDB entries)

8. Domain d3wjda_: 3wjd A: [238332]
   automated match to d2a13a1
   complexed with gol; mutant

Details for d3wjda_

PDB Entry: 3wjd, 1.1 Å

PDB Description: crystal structure of mutant nitrobindin f44w/m75l/h76l/q96c/m148l/h158l (nb5) from arabidopsis thaliana

PDB Compounds: (A:) UPF0678 fatty acid-binding protein-like protein At1g79260

SCOPe Domain Sequences for d3wjda_:

Sequence; same for both SEQRES and ATOM records:

>d3wjda_ b.60.1.8 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ppvhpfvaplsyllgtwrgqgegeyptipswrygeeirfshsgkpviaytqktwklesga
pllaesgyfrprpdgsievviacstglvevqkgtynvdeqsiklksdlvgnaskvkeisr
efelvdgklsyvvrlstttnplqpllkaildkl

Timeline for d3wjda_:

• d3wjda_ first appeared in SCOPe 2.03
  
• d3wjda_ appears in SCOPe 2.05
  
• d3wjda_ appears in SCOPe 2.07
  
• d3wjda_ appears in the current release, SCOPe 2.08