Lineage for d4hmge_ (4hmg E:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662496Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 662497Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 662542Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (1 protein)
  6. 662543Protein Hemagglutinin [49824] (1 species)
    includes rudiment esterase domain
  7. 662544Species Influenza A virus, different strains [TaxId:11320] [49825] (39 PDB entries)
  8. 662623Domain d4hmge_: 4hmg E: [23833]
    Other proteins in same PDB: d4hmgb_, d4hmgd_, d4hmgf_
    complexed with man, nag, sia; mutant

Details for d4hmge_

PDB Entry: 4hmg (more details), 3 Å

PDB Description: refinement of the influenza virus hemagglutinin by simulated annealing
PDB Compounds: (E:) hemagglutinin, chain ha1

SCOP Domain Sequences for d4hmge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hmge_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrgqssrisiywtivkpg
dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
tygacpkyvkqntlklatgmrnvpekqt

SCOP Domain Coordinates for d4hmge_:

Click to download the PDB-style file with coordinates for d4hmge_.
(The format of our PDB-style files is described here.)

Timeline for d4hmge_: