![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.17: Fungal lipases [53558] (5 proteins) |
![]() | Protein automated matches [190510] (9 species) not a true protein |
![]() | Species Candida antarctica [TaxId:34362] [236429] (5 PDB entries) |
![]() | Domain d3w9bc_: 3w9b C: [238327] automated match to d1tcaa_ complexed with pe8 |
PDB Entry: 3w9b (more details), 2.9 Å
SCOPe Domain Sequences for d3w9bc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w9bc_ c.69.1.17 (C:) automated matches {Candida antarctica [TaxId: 34362]} lpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplstqlg ytpcwispppfmlndtqvnteymvnaitalyagsgnnklpvltwsqgglvaqwgltffps irskvdrlmafapdykgtvlagpldalavsapsvwqqttgsalttalrnaggltqivptt nlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgrsa lrsttgqarsadygitdcnplpandltpeqkvaaaallapaaaaivagpkqncepdlmpy arpfavgkrtcsgivtp
Timeline for d3w9bc_: