| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
| Protein automated matches [190543] (40 species) not a true protein |
| Species Chitinophaga pinensis [TaxId:485918] [238323] (1 PDB entry) |
| Domain d4pw0a_: 4pw0 A: [238324] automated match to d4lxga_ complexed with cl |
PDB Entry: 4pw0 (more details), 1.48 Å
SCOPe Domain Sequences for d4pw0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pw0a_ c.69.1.0 (A:) automated matches {Chitinophaga pinensis [TaxId: 485918]}
ndhataptqyievngtryayrslgapsdiplicfqhftgtldnwdplitnglskgrqlii
fdnkgvglssgttpdnvaamtadalefitalgiryfdvlgfslggfivqymahiqpdmir
kiiivgaapqgvkvlhtfpdliaramqlepkerflfiffeqsehsrskglatlgrlyert
tdrdqdasaqaigaqltaitnwgkktpsfeitsiqhpvfvvqgsndemmdtynsyelfkq
lpdailslypdaahgsfyqypelfvsqteyfldsy
Timeline for d4pw0a_: