SCOPe 2.04: Domain d4pv4a2: 4pv4 A:175-436

Lineage for d4pv4a2 (4pv4 A:175-436)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)

6. Protein automated matches [195197] (4 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [238319] (1 PDB entry)

8. Domain d4pv4a2: 4pv4 A:175-436 [238322]
   Other proteins in same PDB: d4pv4a1, d4pv4b1
   automated match to d1n51a2
   complexed with 1pe, edo, mg, p6g, pge

Details for d4pv4a2

PDB Entry: 4pv4, 1.76 Å

PDB Description: proline aminopeptidase p ii from yersinia pestis

PDB Compounds: (A:) Proline aminopeptidase P II

SCOPe Domain Sequences for d4pv4a2:

Sequence; same for both SEQRES and ATOM records:

>d4pv4a2 d.127.1.1 (A:175-436) automated matches {Yersinia pestis [TaxId: 632]}
saeeiavlrrageisalahtramekcrpgmfeyqlegeilheftrhgarypayntivggg
engcilhytenecelrdgdlvlidagceyrgyagditrtfpvngkftpaqravydivlaa
inksltlfrpgtsirevteevvrimvvglvelgilkgdieqliaeqahrpffmhglshwl
gmdvhdvgdygssdrgrilepgmvltvepglyiapdadvppqyrgigirieddivitatg
nenltasvvkdpddiealmaln

Timeline for d4pv4a2:

• d4pv4a2 first appeared in SCOPe 2.03
  
• d4pv4a2 appears in SCOPe 2.05
  
• d4pv4a2 appears in the current release, SCOPe 2.08