SCOPe 2.06: Domain d4pqwa1: 4pqw A:11-94

Lineage for d4pqwa1 (4pqw A:11-94)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (40 PDB entries)

8. Domain d4pqwa1: 4pqw A:11-94 [238314]
   Other proteins in same PDB: d4pqwa2, d4pqwa3
   automated match to d1i92a_
   complexed with cl, ni

Details for d4pqwa1

PDB Entry: 4pqw, 1.47 Å

PDB Description: Crystal Structure of Phospholipase C beta 3 in Complex with PDZ1 of NHERF1

PDB Compounds: (A:) Na(+)/H(+) exchange regulatory cofactor NHE-RF1

SCOPe Domain Sequences for d4pqwa1:

Sequence; same for both SEQRES and ATOM records:

>d4pqwa1 b.36.1.1 (A:11-94) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenveke
thqqvvsriraalnavrllvvdpe

Timeline for d4pqwa1:

• d4pqwa1 first appeared in SCOPe 2.03, called d4pqwa_
  
• d4pqwa1 was called d4pqwa_ in SCOPe 2.05
  
• d4pqwa1 appears in SCOPe 2.07
  
• d4pqwa1 appears in the current release, SCOPe 2.08