Class b: All beta proteins [48724] (176 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein automated matches [190055] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187785] (42 PDB entries) |
Domain d4pqwa_: 4pqw A: [238314] automated match to d1i92a_ complexed with cl, ni |
PDB Entry: 4pqw (more details), 1.47 Å
SCOPe Domain Sequences for d4pqwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pqwa_ b.36.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gmlprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenve kethqqvvsriraalnavrllvvdpeentql
Timeline for d4pqwa_: