Lineage for d4p3xa_ (4p3x A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2152064Fold c.145: NadA-like [142753] (1 superfamily)
    duplication; consists of three similar domains related by pseudo threefold symmetry; 3 layers, a/b/a; parallel beta sheet, order: 2134
  4. 2152065Superfamily c.145.1: NadA-like [142754] (2 families) (S)
    automatically mapped to Pfam PF02445
  5. 2152070Family c.145.1.0: automated matches [238306] (1 protein)
    not a true family
  6. 2152071Protein automated matches [238307] (1 species)
    not a true protein
  7. 2152072Species Thermotoga maritima [TaxId:243274] [238308] (6 PDB entries)
  8. 2152073Domain d4p3xa_: 4p3x A: [238309]
    automated match to d1wzua1
    complexed with mpd, sf4, zn

Details for d4p3xa_

PDB Entry: 4p3x (more details), 1.65 Å

PDB Description: structure of the fe4s4 quinolinate synthase nada from thermotoga maritima
PDB Compounds: (A:) Quinolinate synthase A

SCOPe Domain Sequences for d4p3xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p3xa_ c.145.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
mhhhhhhmvdeilklkkekgyiilahnyqipelqdiadfvgdslqlarkamelsekkilf
lgvdfmaelvkilnpdkkvivpdrsatcpmanrltpeiireyrekfpdapvvlyvnstse
cktladvictsanavevvkkldssvvifgpdrnlgeyvaektgkkvitipenghcpvhqf
naesidavrkkypdakvivhpecpkpvrdkadyvgstgqmekiperdpsrifvigteigm
ihklkkkfpdrefvplemavcvnmkkntlentlhalqtesfevilpkeviekakkpilrm
felmg

SCOPe Domain Coordinates for d4p3xa_:

Click to download the PDB-style file with coordinates for d4p3xa_.
(The format of our PDB-style files is described here.)

Timeline for d4p3xa_: