Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families) automatically mapped to Pfam PF02764 |
Family f.1.2.1: Diphtheria toxin, middle domain [56846] (1 protein) |
Protein Diphtheria toxin, middle domain [56847] (1 species) contains globin-like fold with two additional helices at N-termini but has no counterpart to the first globin helix (A) |
Species Corynebacterium diphtheriae [TaxId:1717] [56848] (7 PDB entries) |
Domain d4ow6b2: 4ow6 B:200-380 [238297] Other proteins in same PDB: d4ow6a1, d4ow6a3, d4ow6b1, d4ow6b3 automated match to d1ddta3 missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 4ow6 (more details), 2.8 Å
SCOPe Domain Sequences for d4ow6b2:
Sequence, based on SEQRES records: (download)
>d4ow6b2 f.1.2.1 (B:200-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae [TaxId: 1717]} scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa y
>d4ow6b2 f.1.2.1 (B:200-380) Diphtheria toxin, middle domain {Corynebacterium diphtheriae [TaxId: 1717]} scinldwdvirdktktkieslehpelselktvtgtnpvfaganyaawavnvaqvidseta dnlekttaalsilpgigsvmgiadgavhhnteeivaqsialsslmvaqaiplvgelvdig faaynfvesiinlfqvvhnsynrpay
Timeline for d4ow6b2: