SCOPe 2.03: Domain d4ok3a1: 4ok3 A:187-325

Lineage for d4ok3a1 (4ok3 A:187-325)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (4 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein HCV helicase domain [52725] (1 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (16 PDB entries)

8. Domain d4ok3a1: 4ok3 A:187-325 [238286]
   automated match to d4ojqa1
   complexed with 2sy, ca

Details for d4ok3a1

PDB Entry: 4ok3, 2.3 Å

PDB Description: Crystal Structure of Hepatitis C Virus NS3 Helicase Inhibitor Co-complex with Compound 7 [[1-(3-chlorobenzyl)-1H-indol-3-yl]acetic acid]

PDB Compounds: (A:) Serine protease NS3

SCOPe Domain Sequences for d4ok3a1:

Sequence; same for both SEQRES and ATOM records:

>d4ok3a1 c.37.1.14 (A:187-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
nssppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskah
gvdpnirtgvrtittgspitystygkfladggcsggaydiiicdechstdatsilgigtv
ldqaetagarlvvlatatp

Timeline for d4ok3a1:

• d4ok3a1 is new in SCOPe 2.03-stable
  
• d4ok3a1 appears in SCOPe 2.04
  
• d4ok3a1 appears in the current release, SCOPe 2.08