Lineage for d4oj8a1 (4oj8 A:3-272)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2404605Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2404840Family b.82.2.8: gamma-Butyrobetaine hydroxylase [89416] (3 protein domains)
    Pfam PF03322
  6. 2404841Protein Carbapenem synthase, CarC [89417] (2 species)
  7. 2404849Species Pectobacterium carotovorum [TaxId:555] [238281] (1 PDB entry)
  8. 2404850Domain d4oj8a1: 4oj8 A:3-272 [238283]
    Other proteins in same PDB: d4oj8a2, d4oj8b2, d4oj8c2
    automated match to d1nx4c_
    complexed with 2tq, akg, fe2, gol

Details for d4oj8a1

PDB Entry: 4oj8 (more details), 2.1 Å

PDB Description: crystal structure of carbapenem synthase in complex with (3s,5s)- carbapenam
PDB Compounds: (A:) (5R)-carbapenem-3-carboxylate synthase

SCOPe Domain Sequences for d4oj8a1:

Sequence, based on SEQRES records: (download)

>d4oj8a1 b.82.2.8 (A:3-272) Carbapenem synthase, CarC {Pectobacterium carotovorum [TaxId: 555]}
eivkfnpvmasgfgayidhrdfleaktetiknllmrqgfvvvknldidsdtfrdiysayg
tiveyadekigvgfgyrdtlklegekgkivtgrgqlpfhadgglllsqvdqvflyaaeik
nvkfrgattvcdhalacqempahllrvleeetfevrvlergyyvdvspdgwfkvpvftdl
gwvrkmliyfpfdegqpasweprivgftdhetqaffqelgaflkqpryyykhfwedgdll
imdnrrvihereefndddivrrlyrgqtad

Sequence, based on observed residues (ATOM records): (download)

>d4oj8a1 b.82.2.8 (A:3-272) Carbapenem synthase, CarC {Pectobacterium carotovorum [TaxId: 555]}
eivkfnpvmasgfgayidhrdfleaktetiknllmrqgfvvvknldidsdtfrdiysayg
tiveyvgfgyrdtlklegekgkivtgrgqlpfhadgglllsqvdqvflyaaeiknvkfrg
attvcdhalacqempahllrvleeetfevrvlwfkvpvftdlgwvrkmliyfpfdegqpa
sweprivgftdhetqaffqelgaflkqpryyykhfwedgdllimdnrrvihereefnddd
ivrrlyrgqtad

SCOPe Domain Coordinates for d4oj8a1:

Click to download the PDB-style file with coordinates for d4oj8a1.
(The format of our PDB-style files is described here.)

Timeline for d4oj8a1: