Lineage for d4oj8b_ (4oj8 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807787Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 1807980Family b.82.2.8: gamma-Butyrobetaine hydroxylase [89416] (3 proteins)
    Pfam PF03322
  6. 1807981Protein Carbapenem synthase, CarC [89417] (2 species)
  7. 1807989Species Pectobacterium carotovorum [TaxId:555] [238281] (1 PDB entry)
  8. 1807991Domain d4oj8b_: 4oj8 B: [238282]
    automated match to d1nx4c_
    complexed with 2tq, akg, fe2, gol

Details for d4oj8b_

PDB Entry: 4oj8 (more details), 2.1 Å

PDB Description: crystal structure of carbapenem synthase in complex with (3s,5s)- carbapenam
PDB Compounds: (B:) (5R)-carbapenem-3-carboxylate synthase

SCOPe Domain Sequences for d4oj8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oj8b_ b.82.2.8 (B:) Carbapenem synthase, CarC {Pectobacterium carotovorum [TaxId: 555]}
seivkfnpvmasgfgayidhrdfleaktetiknllmrqgfvvvknldidsdtfrdiysay
gtiveyadekigvgfgyrdtlklegekgkivtgrgqlpfhadgglllsqvdqvflyaaei
knvkfrgattvcdhalacqempahllrvleeetfevrvlergyyvdvspdgwfkvpvftd
lgwvrkmliyfpfdegqpasweprivgftdhetqaffqelgaflkqpryyykhfwedgdl
limdnrrvihereefndddivrrlyrgqtad

SCOPe Domain Coordinates for d4oj8b_:

Click to download the PDB-style file with coordinates for d4oj8b_.
(The format of our PDB-style files is described here.)

Timeline for d4oj8b_: