Lineage for d4occe_ (4occ E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712363Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2712364Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2712365Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 2712372Protein MDM2 [47594] (2 species)
  7. 2712390Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries)
  8. 2712435Domain d4occe_: 4occ E: [238274]
    automated match to d1t4ea_
    complexed with 2tz

Details for d4occe_

PDB Entry: 4occ (more details), 1.8 Å

PDB Description: co-crystal structure of MDM2(17-111) in complex with compound 48
PDB Compounds: (E:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4occe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4occe_ a.42.1.1 (E:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
sndllgdlfgvpsfsvkehrkiytmiyrnlvvv

SCOPe Domain Coordinates for d4occe_:

Click to download the PDB-style file with coordinates for d4occe_.
(The format of our PDB-style files is described here.)

Timeline for d4occe_: