SCOP 1.73: Domain d3hmge_: 3hmg E:

Lineage for d3hmge_ (3hmg E:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (3 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (1 protein)

6. Protein Hemagglutinin [49824] (1 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (39 PDB entries)

8. Domain d3hmge_: 3hmg E: [23827]
   Other proteins in same PDB: d3hmgb_, d3hmgd_, d3hmgf_
   complexed with man, nag; mutant

Details for d3hmge_

PDB Entry: 3hmg, 2.9 Å

PDB Description: refinement of the influenza virus hemagglutinin by simulated annealing

PDB Compounds: (E:) Hemagglutinin

SCOP Domain Sequences for d3hmge_:

Sequence; same for both SEQRES and ATOM records:

>d3hmge_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrgqssrisiywtivkpg
dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
tygacpkyvkqntlklatgmrnvpekqt

Timeline for d3hmge_:

• d3hmge_ first appeared (with stable ids) in SCOP 1.55
  
• d3hmge_ appears in SCOP 1.71
  
• d3hmge_ appears in SCOP 1.75
  
• d3hmge_ appears in the current release, SCOPe 2.08