Lineage for d4nbpa_ (4nbp A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569784Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 2569785Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 2569786Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins)
  6. 2569787Protein The origin DNA-binding domain of SV40 T-antigen [55466] (2 species)
  7. 2569788Species Jc polyomavirus [TaxId:10632] [237285] (4 PDB entries)
  8. 2569789Domain d4nbpa_: 4nbp A: [238252]
    automated match to d4lifa_
    complexed with tla

Details for d4nbpa_

PDB Entry: 4nbp (more details), 1.31 Å

PDB Description: Crystal structure of the JCV large T-antigen origin binding domain
PDB Compounds: (A:) large t antigen

SCOPe Domain Sequences for d4nbpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nbpa_ d.89.1.1 (A:) The origin DNA-binding domain of SV40 T-antigen {Jc polyomavirus [TaxId: 10632]}
vedpkdfpvdlhaflsqavfsnrtvasfavyttkekaqilykklmekysvtfisrhgfgg
hnilffltphrhrvsainnycqklctfsflickgvnkeylfysalcrqpyavveesiqgg
lkehdfnpe

SCOPe Domain Coordinates for d4nbpa_:

Click to download the PDB-style file with coordinates for d4nbpa_.
(The format of our PDB-style files is described here.)

Timeline for d4nbpa_: