![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (26 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46501] (284 PDB entries) Uniprot P68871 |
![]() | Domain d4n7ol_: 4n7o L: [238244] Other proteins in same PDB: d4n7oa_, d4n7oc_, d4n7oe_, d4n7og_, d4n7oi_, d4n7ok_ automated match to d1irdb_ complexed with hem, hni |
PDB Entry: 4n7o (more details), 2.5 Å
SCOPe Domain Sequences for d4n7ol_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n7ol_ a.1.1.2 (L:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} vhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d4n7ol_: