![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (24 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46487] (291 PDB entries) Uniprot P69905 P01922 P01934 P01935 |
![]() | Domain d4n7oa_: 4n7o A: [238239] Other proteins in same PDB: d4n7ob_, d4n7od_, d4n7of_, d4n7oh_, d4n7oj_, d4n7ol_ automated match to d1irda_ complexed with hem, hni |
PDB Entry: 4n7o (more details), 2.5 Å
SCOPe Domain Sequences for d4n7oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n7oa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyr
Timeline for d4n7oa_: