SCOPe 2.08: Domain d4n5pe_: 4n5p E:

Lineage for d4n5pe_ (4n5p E:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
   includes alpha-helical C-terminal domain characteristic for the family

6. Protein Thermolysin [63414] (3 species)

7. Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (191 PDB entries)
   Uniprot P00800

8. Domain d4n5pe_: 4n5p E: [238223]
   automated match to d1kkka_
   complexed with 2h0, ca, dms, gol, zn

Details for d4n5pe_

PDB Entry: 4n5p, 1.25 Å

PDB Description: Thermolysin in complex with UBTLN20

PDB Compounds: (E:) thermolysin

SCOPe Domain Sequences for d4n5pe_:

Sequence; same for both SEQRES and ATOM records:

>d4n5pe_ d.92.1.2 (E:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]}
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

Timeline for d4n5pe_:

• d4n5pe_ first appeared in SCOPe 2.03
  
• d4n5pe_ appears in SCOPe 2.07