Lineage for d1qfua_ (1qfu A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793348Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 793349Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 793394Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (1 protein)
  6. 793395Protein Hemagglutinin [49824] (1 species)
    includes rudiment esterase domain
  7. 793396Species Influenza A virus, different strains [TaxId:11320] [49825] (39 PDB entries)
  8. 793448Domain d1qfua_: 1qfu A: [23822]
    Other proteins in same PDB: d1qfub_, d1qfuh1, d1qfuh2, d1qful1, d1qful2
    complexed with man, nag

Details for d1qfua_

PDB Entry: 1qfu (more details), 2.8 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody
PDB Compounds: (A:) protein (hemagglutinin (ha1 chain))

SCOP Domain Sequences for d1qfua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfua_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpek

SCOP Domain Coordinates for d1qfua_:

Click to download the PDB-style file with coordinates for d1qfua_.
(The format of our PDB-style files is described here.)

Timeline for d1qfua_: