Lineage for d4mlqa2 (4mlq A:219-308)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2514439Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2514639Superfamily d.50.2: Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain [54782] (2 families) (S)
    automatically mapped to Pfam PF03900
  5. 2514648Family d.50.2.0: automated matches [227289] (1 protein)
    not a true family
  6. 2514649Protein automated matches [227108] (3 species)
    not a true protein
  7. 2514650Species Bacillus megaterium [TaxId:1404] [238215] (5 PDB entries)
  8. 2514652Domain d4mlqa2: 4mlq A:219-308 [238216]
    Other proteins in same PDB: d4mlqa1, d4mlqa3
    automated match to d1gtka2
    complexed with 29p, acy, dpm

Details for d4mlqa2

PDB Entry: 4mlq (more details), 1.6 Å

PDB Description: Crystal structure of Bacillus megaterium porphobilinogen deaminase
PDB Compounds: (A:) porphobilinogen deaminase

SCOPe Domain Sequences for d4mlqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mlqa2 d.50.2.0 (A:219-308) automated matches {Bacillus megaterium [TaxId: 1404]}
nhdetaravraervflkemeggcqvpiagygrildggnieltslvaspdgktiykehitg
kdpiaigseaaerltsqgakllidrvkeel

SCOPe Domain Coordinates for d4mlqa2:

Click to download the PDB-style file with coordinates for d4mlqa2.
(The format of our PDB-style files is described here.)

Timeline for d4mlqa2: