| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
| Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
| Protein automated matches [190459] (61 species) not a true protein |
| Species Soybean (Glycine max) [TaxId:3847] [237649] (1 PDB entry) |
| Domain d4mafg2: 4maf G:219-449 [238200] Other proteins in same PDB: d4mafa1, d4mafb1, d4mafb3, d4mafc1, d4mafc3, d4mafd1, d4mafe1, d4mafe3, d4maff1, d4mafg1, d4mafg3, d4mafh1 automated match to d4mafc2 complexed with adx |
PDB Entry: 4maf (more details), 2.48 Å
SCOPe Domain Sequences for d4mafg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mafg2 c.26.1.0 (G:219-449) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gldhfrlsptqlraeftrrnadavfafqlrnpvhnghallmtdtrkrllemgyknpvlll
hplggytkaddvpldwrmkqhekvledgvldpettvvsifpspmhyagptevqwhakari
naganfyivgrdpagmshpvekrdlydadhgkkvlsmapglerlnilpfrvaaydktqgk
maffdpsrpqdflfisgtkmrtlarnkesppdgfmcpggwkvlvdyydslv
Timeline for d4mafg2: