SCOPe 2.04: Domain d4mafd2: 4maf D:219-448

Lineage for d4mafd2 (4maf D:219-448)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (36 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [237649] (1 PDB entry)

8. Domain d4mafd2: 4maf D:219-448 [238196]
   Other proteins in same PDB: d4mafa1, d4mafb1, d4mafc1, d4mafd1, d4mafe1, d4maff1, d4mafg1, d4mafh1
   automated match to d4mafa2
   complexed with adx

Details for d4mafd2

PDB Entry: 4maf, 2.48 Å

PDB Description: Soybean ATP Sulfurylase

PDB Compounds: (D:) ATP sulfurylase

SCOPe Domain Sequences for d4mafd2:

Sequence; same for both SEQRES and ATOM records:

>d4mafd2 c.26.1.0 (D:219-448) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gldhfrlsptqlraeftrrnadavfafqlrnpvhnghallmtdtrkrllemgyknpvlll
hplggytkaddvpldwrmkqhekvledgvldpettvvsifpspmhyagptevqwhakari
naganfyivgrdpagmshpvekrdlydadhgkkvlsmapglerlnilpfrvaaydktqgk
maffdpsrpqdflfisgtkmrtlarnkesppdgfmcpggwkvlvdyydsl

Timeline for d4mafd2:

• d4mafd2 first appeared in SCOPe 2.03
  
• d4mafd2 appears in SCOPe 2.05
  
• d4mafd2 appears in the current release, SCOPe 2.08