![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species) PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries) Uniprot Q08881 357-619 |
![]() | Domain d4m13a_: 4m13 A: [238188] automated match to d4hcta_ complexed with 1e0 |
PDB Entry: 4m13 (more details), 1.85 Å
SCOPe Domain Sequences for d4m13a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m13a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} kwvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmkls hpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayle eacvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsr yssksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhc wrerpedrpafsrllrqlaeiaes
Timeline for d4m13a_: