SCOPe 2.08: Domain d4m14a_: 4m14 A:

Lineage for d4m14a_ (4m14 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
   PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
   Uniprot Q08881 357-619

8. Domain d4m14a_: 4m14 A: [238187]
   automated match to d4hcta_
   complexed with qws

Details for d4m14a_

PDB Entry: 4m14, 1.55 Å

PDB Description: Crystal structure of ITK in complex with compound 9 [4-(carbamoylamino)-1-[7-(propan-2-yloxy)naphthalen-1-yl]-1H-pyrazole-3-carboxamide]

PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d4m14a_:

Sequence; same for both SEQRES and ATOM records:

>d4m14a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
kwvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmkls
hpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayle
eacvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsr
yssksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhc
wrerpedrpafsrllrqlaeiae

Timeline for d4m14a_:

• d4m14a_ first appeared in SCOPe 2.03
  
• d4m14a_ appears in SCOPe 2.07