Lineage for d4ls5b2 (4ls5 B:251-411)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917421Species Bacillus subtilis [TaxId:224308] [238173] (5 PDB entries)
  8. 2917433Domain d4ls5b2: 4ls5 B:251-411 [238177]
    automated match to d3u0fa2
    complexed with gol, k

Details for d4ls5b2

PDB Entry: 4ls5 (more details), 1.8 Å

PDB Description: Crystal structure of beta-ketoacyl-ACP synthase II (FabF) from Bacillus subtilis
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4ls5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ls5b2 c.95.1.0 (B:251-411) automated matches {Bacillus subtilis [TaxId: 224308]}
kiygeivgygstgdayhitapaqdgeggaramqeaikdagiapeeidyinahgtstyynd
kyetmaiktvfgehahklavsstksmtghllgaaggieaifsilaikegvipptiniqtp
deecdldyvpdearrqelnyvlsnslgfgghnatlifkkyq

SCOPe Domain Coordinates for d4ls5b2:

Click to download the PDB-style file with coordinates for d4ls5b2.
(The format of our PDB-style files is described here.)

Timeline for d4ls5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ls5b1