| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
| Protein automated matches [196909] (83 species) not a true protein |
| Species Bacillus subtilis [TaxId:224308] [238173] (5 PDB entries) |
| Domain d4ls5b1: 4ls5 B:0-250 [238175] automated match to d3u0fa1 complexed with gol, k |
PDB Entry: 4ls5 (more details), 1.8 Å
SCOPe Domain Sequences for d4ls5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ls5b1 c.95.1.0 (B:0-250) automated matches {Bacillus subtilis [TaxId: 224308]}
mtkkrvvvtglgalsplgndvdtswnnaingvsgigpitrvdaeeypakvaaelkdfnve
dymdkkearkmdrftqyavvaakmavedadlnitdeiaprvgvwvgsgiggletlesqfe
ifltkgprrvspffvpmmipdmatgqisialgakgvnsctvtacatgtnsigdafkviqr
gdadvmvtggteapltrmsfagfsankalstnpdpktasrpfdknrdgfvmgegagiivl
eelehalarga
Timeline for d4ls5b1: