Lineage for d4lmyb1 (4lmy B:1-155)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308514Species Streptococcus pyogenes [TaxId:198466] [193090] (2 PDB entries)
  8. 2308516Domain d4lmyb1: 4lmy B:1-155 [238172]
    Other proteins in same PDB: d4lmyb2
    automated match to d4i7hb_
    complexed with zn

Details for d4lmyb1

PDB Entry: 4lmy (more details), 1.6 Å

PDB Description: Structure of GAS PerR-Zn-Zn
PDB Compounds: (B:) Peroxide stress regulator PerR, FUR family

SCOPe Domain Sequences for d4lmyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lmyb1 a.4.5.0 (B:1-155) automated matches {Streptococcus pyogenes [TaxId: 198466]}
mdihshqqaldayenvlehlrekhiritetrkaiisymiqstehpsadkiyrdlqpnfpn
mslatvynnlkvlvdegfvselkisndlttyydfmghqhvnvvceicgkiadfmdvdvmd
iakeaheqtgykvtripviaygicpdcqakdqpdf

SCOPe Domain Coordinates for d4lmyb1:

Click to download the PDB-style file with coordinates for d4lmyb1.
(The format of our PDB-style files is described here.)

Timeline for d4lmyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lmyb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4lmya_