| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (41 species) not a true protein |
| Species Streptococcus pyogenes [TaxId:198466] [193090] (2 PDB entries) |
| Domain d4lmyb_: 4lmy B: [238172] automated match to d4i7hb_ complexed with zn |
PDB Entry: 4lmy (more details), 1.6 Å
SCOPe Domain Sequences for d4lmyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lmyb_ a.4.5.0 (B:) automated matches {Streptococcus pyogenes [TaxId: 198466]}
mdihshqqaldayenvlehlrekhiritetrkaiisymiqstehpsadkiyrdlqpnfpn
mslatvynnlkvlvdegfvselkisndlttyydfmghqhvnvvceicgkiadfmdvdvmd
iakeaheqtgykvtripviaygicpdcqakdqpdfle
Timeline for d4lmyb_: