Lineage for d4lmdb_ (4lmd B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660345Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 1660346Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 1660347Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins)
  6. 1660348Protein The origin DNA-binding domain of SV40 T-antigen [55466] (2 species)
  7. 1660349Species Jc polyomavirus [TaxId:10632] [237285] (3 PDB entries)
  8. 1660352Domain d4lmdb_: 4lmd B: [238170]
    automated match to d4lifa_
    complexed with flc, gol

Details for d4lmdb_

PDB Entry: 4lmd (more details), 1.5 Å

PDB Description: Crystal structure of the JCV large t-antigen origin binding domain
PDB Compounds: (B:) large t antigen

SCOPe Domain Sequences for d4lmdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lmdb_ d.89.1.1 (B:) The origin DNA-binding domain of SV40 T-antigen {Jc polyomavirus [TaxId: 10632]}
kvedpkdfpvdlhaflsqavfsnrtvasfavyttkekaqilykklmekysvtfisrhgfg
ghnilffltphrhrvsainnycqklctfsflickgvnkeylfysalcrqpyavveesiqg
glkehdfnpe

SCOPe Domain Coordinates for d4lmdb_:

Click to download the PDB-style file with coordinates for d4lmdb_.
(The format of our PDB-style files is described here.)

Timeline for d4lmdb_: