Lineage for d4k10d_ (4k10 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731887Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2731888Protein automated matches [196409] (46 species)
    not a true protein
  7. 2731945Species Leishmania major [TaxId:5664] [236738] (6 PDB entries)
  8. 2731959Domain d4k10d_: 4k10 D: [238159]
    automated match to d4jzba_
    complexed with act, mes, mg, na, ni9, peg

Details for d4k10d_

PDB Entry: 4k10 (more details), 2.3 Å

PDB Description: crystal structure of leshmaniasis major farnesyl diphosphate synthase in complex with 3-fluoro-1-(2-hydroxy-2,2-diphosphonoethyl)pyridinium and mg2+
PDB Compounds: (D:) farnesyl pyrophosphate synthase

SCOPe Domain Sequences for d4k10d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k10d_ a.128.1.0 (D:) automated matches {Leishmania major [TaxId: 5664]}
mahmerfqkvyeevqefllgdaekrfemdvhrkgylksmmdttclggkynrglcvvdvae
amakdtqmdaaamervlhdacvcgwmiemlqahflveddimdhsktrrgkpcwylhpgvt
aqvaindglillawatqmalhyfadrpflaevlrvfhdvdltttigqlydvtsmvdsakl
dakvahanttdyveytpfnhrrivvyktayytywlplvmgllvsgtlekvdkkathkvam
vmgeyfqvqddvmdcftppeklgkigtdiedakcswlavtflttapaekvaefkanygst
dpaavavikqlyteqnllarfeeyekavvaeveqliaaleaqnaafaasvkvlwsktykr

SCOPe Domain Coordinates for d4k10d_:

Click to download the PDB-style file with coordinates for d4k10d_.
(The format of our PDB-style files is described here.)

Timeline for d4k10d_: