Lineage for d4jzga1 (4jzg A:29-120)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2302754Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303043Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303322Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2303323Protein automated matches [226859] (35 species)
    not a true protein
  7. 2303384Species Clostridium difficile [TaxId:272563] [226452] (4 PDB entries)
  8. 2303388Domain d4jzga1: 4jzg A:29-120 [238153]
    Other proteins in same PDB: d4jzga2
    automated match to d3tjta1
    complexed with mn

Details for d4jzga1

PDB Entry: 4jzg (more details), 2.32 Å

PDB Description: Crystal structure of a single cambialistic SOD2 occupied by Manganese ion from Clostridium difficile
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d4jzga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jzga1 a.2.11.0 (A:29-120) automated matches {Clostridium difficile [TaxId: 272563]}
nnkfkvkplpyaydalepyidketmklhhdkhyqayvdklnaalekypelynyslcellq
nldslpkdiattvrnnaggaynhkfffdimtp

SCOPe Domain Coordinates for d4jzga1:

Click to download the PDB-style file with coordinates for d4jzga1.
(The format of our PDB-style files is described here.)

Timeline for d4jzga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jzga2