| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
| Protein automated matches [226859] (39 species) not a true protein |
| Species Clostridium difficile [TaxId:272563] [226452] (4 PDB entries) |
| Domain d4jzga1: 4jzg A:29-120 [238153] Other proteins in same PDB: d4jzga2 automated match to d3tjta1 complexed with mn |
PDB Entry: 4jzg (more details), 2.32 Å
SCOPe Domain Sequences for d4jzga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jzga1 a.2.11.0 (A:29-120) automated matches {Clostridium difficile [TaxId: 272563]}
nnkfkvkplpyaydalepyidketmklhhdkhyqayvdklnaalekypelynyslcellq
nldslpkdiattvrnnaggaynhkfffdimtp
Timeline for d4jzga1: