Lineage for d4jz6a1 (4jz6 A:1-483)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481726Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2481727Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2482164Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2482165Protein automated matches [190683] (55 species)
    not a true protein
  7. 2482684Species Pseudomonas putida [TaxId:303] [238151] (1 PDB entry)
  8. 2482685Domain d4jz6a1: 4jz6 A:1-483 [238152]
    Other proteins in same PDB: d4jz6a2
    automated match to d3iwja_
    complexed with edo, nk, so4

Details for d4jz6a1

PDB Entry: 4jz6 (more details), 2.42 Å

PDB Description: crystal structure of a salicylaldehyde dehydrogenase from pseudomonas putida g7 complexed with salicylaldehyde
PDB Compounds: (A:) Salicylaldehyde dehydrogenase NahF

SCOPe Domain Sequences for d4jz6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jz6a1 c.82.1.0 (A:1-483) automated matches {Pseudomonas putida [TaxId: 303]}
mktklfinnawidssdqqtferkhpvssevmtesanatvtdaikaaqaaeeafktwkdvg
pserrrlllkvadvmesktpkfievmamevgasalwagfnvhasanvfreaaslatqiqg
etiptdkaetlsmtlrqpvgpilsivpwngtavlaaraiayplvcgntvvfkgsefspat
halitqcvqeaglpagvlnylnsspdrspeiadalisakeirrinftgstrvgsiiaqka
aqhlkrcllelggksplivlddadinaavkaavfgsflfqgqicmsterlvvdekiadef
varfvekterlsvgdpcltgdciigpmvspnsgeringlfkdaidkgakvvcggmaqgav
mpatildhvksdmriydeetfgpitvvirckgeaeairiandsvyglssgvfgrdinral
rvgmsieygcvhingstvqneaqapyggtkntgygrfdgravideftelkwltiepfeqq
ypf

SCOPe Domain Coordinates for d4jz6a1:

Click to download the PDB-style file with coordinates for d4jz6a1.
(The format of our PDB-style files is described here.)

Timeline for d4jz6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jz6a2