| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
| Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
| Protein automated matches [226860] (25 species) not a true protein |
| Species Clostridium difficile [TaxId:272563] [226453] (4 PDB entries) |
| Domain d4jyya2: 4jyy A:121-230 [238150] Other proteins in same PDB: d4jyya1 automated match to d3tjta2 complexed with azi, fe |
PDB Entry: 4jyy (more details), 2.1 Å
SCOPe Domain Sequences for d4jyya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jyya2 d.44.1.0 (A:121-230) automated matches {Clostridium difficile [TaxId: 272563]}
ektipseslkeaidrdfgsfekfkqefqksaldvfgsgwawlvatkdgklsimttpnqds
pvsknltpiigldvwehayylkyqnrrneyidnwfnvvnwngalenyknl
Timeline for d4jyya2: