Lineage for d4jyya2 (4jyy A:121-230)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) 
automatically mapped to Pfam PF02777
Family d.44.1.0: automated matches [227155] (1 protein)
not a true familyProtein automated matches [226860] (38 species)
not a true protein
Species Clostridium difficile [TaxId:272563] [226453] (4 PDB entries) 
Domain d4jyya2: 4jyy A:121-230 [238150]
Other proteins in same PDB: d4jyya1
automated match to d3tjta2
complexed with azi, fe
Details for d4jyya2
PDB Entry: 4jyy (more details), 2.1 Å
PDB Description: Crystal structure of the azide and iron substituted Clostrium difficile SOD2 complex
PDB Compounds: (A:) superoxide dismutaseSCOPe Domain Sequences for d4jyya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jyya2 d.44.1.0 (A:121-230) automated matches {Clostridium difficile [TaxId: 272563]}
ektipseslkeaidrdfgsfekfkqefqksaldvfgsgwawlvatkdgklsimttpnqds
pvsknltpiigldvwehayylkyqnrrneyidnwfnvvnwngalenyknl
SCOPe Domain Coordinates for d4jyya2:
Click to download the PDB-style file with coordinates for d4jyya2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4jyya2:
- d4jyya2 first appeared in SCOPe 2.03
- d4jyya2 appears in SCOPe 2.07
View in 3D
