Lineage for d4jrua_ (4jru A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777878Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 2777879Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. 2777880Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. 2778007Protein automated matches [190195] (6 species)
    not a true protein
  7. 2778012Species Grape (Vitis vinifera) [TaxId:29760] [194403] (4 PDB entries)
  8. 2778013Domain d4jrua_: 4jru A: [238148]
    automated match to d1z3qa_
    complexed with gol

Details for d4jrua_

PDB Entry: 4jru (more details), 1.2 Å

PDB Description: Structure of haze forming proteins in white wines: Vitis vinifera thaumatin-like proteins
PDB Compounds: (A:) Thaumatin-like protein

SCOPe Domain Sequences for d4jrua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jrua_ b.25.1.1 (A:) automated matches {Grape (Vitis vinifera) [TaxId: 29760]}
atfniqnhcsytvwaaavpgggmqlgsgqswslnvnagttggrvwartncnfdasgngkc
etgdcggllqctaygtppntlaefalnqfsnldffdislvdgfnvpmafnptsngctrgi
sctadivgecpaalkttggcnnpctvfktdeyccnsgscsatdysrffktrcpdaysypk
ddqtstftctagtnyevvfcp

SCOPe Domain Coordinates for d4jrua_:

Click to download the PDB-style file with coordinates for d4jrua_.
(The format of our PDB-style files is described here.)

Timeline for d4jrua_: