SCOPe 2.08: Domain d4jp1a1: 4jp1 A:6-128

Lineage for d4jp1a1 (4jp1 A:6-128)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (9 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [194701] (5 PDB entries)

8. Domain d4jp1a1: 4jp1 A:6-128 [238144]
   Other proteins in same PDB: d4jp1a2
   automated match to d4hnsa_
   complexed with mg

Details for d4jp1a1

PDB Entry: 4jp1, 2.46 Å

PDB Description: Mg2+ bound structure of Vibrio Cholerae CheY3

PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d4jp1a1:

Sequence; same for both SEQRES and ATOM records:

>d4jp1a1 c.23.1.1 (A:6-128) automated matches {Vibrio cholerae [TaxId: 666]}
nknmkilivddfstmrrivknllrdlgfnntqeaddgltalpmlkkgdfdfvvtdwnmpg
mqgidllkniradeelkhlpvlmitaeakreqiieaaqagvngyivkpftaatlkekldk
ife

Timeline for d4jp1a1:

• d4jp1a1 first appeared in SCOPe 2.03, called d4jp1a_
  
• d4jp1a1 appears in SCOPe 2.07