Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.18: HydB/Nqo4-like [56761] (1 superfamily) 3 domains: (1) all-alpha; (2&3) alpha+beta |
Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) |
Family e.18.1.0: automated matches [191637] (1 protein) not a true family |
Protein automated matches [191173] (5 species) not a true protein |
Species Ralstonia eutropha [TaxId:381666] [196117] (5 PDB entries) |
Domain d4iubl_: 4iub L: [238142] Other proteins in same PDB: d4iubs_ automated match to d3rgwl_ complexed with cl, f3s, mg, nfv, po4, s3f, sf4 |
PDB Entry: 4iub (more details), 1.61 Å
SCOPe Domain Sequences for d4iubl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iubl_ e.18.1.0 (L:) automated matches {Ralstonia eutropha [TaxId: 381666]} sayatqgfnlddrgrrivvdpvtrieghmrcevnvdannvirnavstgtmwrglevilkg rdprdawafvericgvctgchalasvravenaldiripknahlireimaktlqvhdhavh fyhlhaldwvdvmsalkadpkrtselqqlvspahplssagyfrdiqnrlkrfvesgqlgp fmngywgskayvlppeanlmavthylealdlqkewvkihtifggknphpnylvggvpcai nldgigaasapvnmerlsfvkarideiiefnknvyvpdvlaigtlykqagwlyggglaat nvldygeypnvaynkstdqlpggailngnwdevfpvdprdsqqvqefvshswykyadesv glhpwdgvtepnyvlgantkgtrtrieqidesakyswiksprwrghamevgplsryilay aharsgnkyaerpkeqleysaqminsaipkalglpetqytlkqllpstigrtlaralesq ycgemmhsdwhdlvaniragdtatanvdkwdpatwplqakgvgtvaaprgalghwirikd grienyqcvvpttwngsprdykgqigafeaslmntpmvnpeqpveilrtlhsfdpclacs th
Timeline for d4iubl_: