Lineage for d4grrc1 (4grr C:4-116)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961019Family d.80.1.3: MIF-related [55339] (3 proteins)
    automatically mapped to Pfam PF01187
  6. 2961039Protein Microphage migration inhibition factor (MIF) [55340] (7 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 2961045Species Human (Homo sapiens) [TaxId:9606] [55341] (94 PDB entries)
  8. 2961069Domain d4grrc1: 4grr C:4-116 [238140]
    Other proteins in same PDB: d4grra2, d4grrb2, d4grrc2
    automated match to d4grqa_
    complexed with avr, cl, so4; mutant

Details for d4grrc1

PDB Entry: 4grr (more details), 1.47 Å

PDB Description: characterization of N- and C- terminus mutants of human MIF
PDB Compounds: (C:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d4grrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4grrc1 d.80.1.3 (C:4-116) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
mfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcsl
hsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

SCOPe Domain Coordinates for d4grrc1:

Click to download the PDB-style file with coordinates for d4grrc1.
(The format of our PDB-style files is described here.)

Timeline for d4grrc1: