SCOPe 2.06: Domain d4crta2: 4crt A:290-401

Lineage for d4crta2 (4crt A:290-401)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)

6. Protein Monoamine oxidase B [69673] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69674] (39 PDB entries)

8. Domain d4crta2: 4crt A:290-401 [238136]
   Other proteins in same PDB: d4crta1, d4crtb1
   automated match to d2v5za2
   complexed with ass, fad

Details for d4crta2

PDB Entry: 4crt, 1.8 Å

PDB Description: Crystal structure of human monoamine oxidase B in complex with the multi-target inhibitor ASS234

PDB Compounds: (A:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d4crta2:

Sequence; same for both SEQRES and ATOM records:

>d4crta2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

Timeline for d4crta2:

• d4crta2 first appeared in SCOPe 2.03
  
• d4crta2 appears in SCOPe 2.05
  
• d4crta2 appears in SCOPe 2.07
  
• d4crta2 appears in the current release, SCOPe 2.08